FGFR-3 alpha (IIIc), Human (HEK293, Fc)
FGFR-3 alpha (IIIc), Human (HEK293, Fc)
SKU:QM-0193932-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 alpha (IIIc) Protein, Human (HEK293, Fc) is the recombinant human-derived FGFR-3 protein, expressed by HEK293 , with C-hFc labeled tag.
-
Molecular Formula
2261 (Gene_ID) P22607-1 (E23-G375) (Accession)
-
Smiles
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
-
Purity
95.02
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0048054-01 [1,4-BIs (diphenylphosphino) butane] (1,5-cyclooctadiene) rhodium (I) (tetrafluoroborate) [CAS 79255-71-3]
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0025230 β-catenin inhibitory peptoid [CAS 2579070-02-1]
- QM-0023369 α-Synuclein inhibitor 14 [CAS 408324-13-0]
- QM-0013035 α-Synuclein inhibitor 15 [CAS 414880-30-1]
- QM-0009265 α-syn aggregation inhibitor-1
- QM-0007272 Zavondemstat (sodium) [CAS 2908753-07-9]
- QM-0006348-01 Xanthoanthrafil-d3 [CAS 1216710-83-6]
- QM-0006347-01 Xanthoanthrafil [CAS 1020251-53-9]
- QM-0002491-01 Ziritaxestat (Standard) [CAS 1628260-79-6]
Other industry favorites
- QM-0048054-01 [1,4-BIs (diphenylphosphino) butane] (1,5-cyclooctadiene) rhodium (I) (tetrafluoroborate) [CAS 79255-71-3]
- QM-0047852-01 [1,4-Bis (diphenylphosphino) butane] (norbornadiene) rhodium (tetrafluoroborate) [CAS 82499-43-2]
- QM-0153508-01 α-Synuclein inhibitor 11
- QM-0156055-01 YAP/TAZ inhibitor-3 [CAS 2506273-81-8]
- QM-0126644 [Leu8, D-Trp22, Tyr25] Somatostatin-28 [CAS 77909-99-0]
- QM-0126181 YAP/TAZ inhibitor-4
- QM-0112034-01 Zamicastat [CAS 1080028-80-3]
- QM-0152031-01 WRN inhibitor 5 [CAS 2923009-95-2]
- QM-0167342 [Lys4] Sarafotoxin S6c [CAS 1219444-22-0]
- QM-0166278 [Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) [CAS 141055-85-8]
FGFR-3 alpha (IIIc), Human (HEK293, Fc)
FGFR-3 alpha (IIIc), Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.