Skip to product information
1 of 1

FGL1, Human (HEK293, His)

FGL1, Human (HEK293, His)

Size

SKU:QM-0198372-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, His) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    2267 (Gene_ID) Q08830 (L23-I312) (Accession)

  • Smiles

    LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0198372-01
5 µgQM-0198372-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0198372-02
10 µgQM-0198372-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0198372-03
50 µgQM-0198372-03
£293.00/ea
£0.00
£293.00/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FGL1, Human (HEK293, His)

FGL1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.