FGL1, Human (HEK293, mFc)

Name: FGL1, Human (HEK293, mFc)
Brand: QuantiMol
SKU: QM-0193845-01
Price: 72.61 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0193845-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.
Molecular Formula
2267 (Gene_ID) Q08830 (L23-I312) (Accession)
Smiles
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Purity
99.18
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0193845-01	5 µgQM-0193845-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0193845-02	10 µgQM-0193845-02 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0193845-03	50 µgQM-0193845-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FGL1, Human (HEK293, mFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.