Skip to product information
1 of 1

FHIT, Human (His)

FHIT, Human (His)

Size

SKU:QM-0202572-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

  • Molecular Formula

    2272 (Gene_ID) P49789 (M1-Q147) (Accession)

  • Smiles

    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202572-01
5 µgQM-0202572-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0202572-02
10 µgQM-0202572-02
£67.44/ea
£0.00
£67.44/ea £0.00
50 µgQM-0202572-03
50 µgQM-0202572-03
£143.13/ea
£0.00
£143.13/ea £0.00
100 µgQM-0202572-04
100 µgQM-0202572-04
£260.19/ea
£0.00
£260.19/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FHIT, Human (His)

FHIT, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.