Skip to product information
1 of 1

Fibronectin, Human (Biotinylated, His-Avi)

Fibronectin, Human (Biotinylated, His-Avi)

Size

SKU:QM-0174872-01

£381.69 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Fibronectin binds collagen, fibrin, heparin, DNA, and actin. It is involved in cell adhesion, motility, opsonization, wound healing and maintenance of cell shape. Fibronectin Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived Fibronectin protein, expressed by E. coli , with N-Avi, N-6*His labeled tag.

  • Molecular Formula

    2335 (Gene_ID) P02751-15 (E1266-T1356) (Accession)

  • Smiles

    EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFT

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0174872-01
20 µgQM-0174872-01
£381.69/ea
£0.00
£381.69/ea £0.00
100 µgQM-0174872-02
100 µgQM-0174872-02
£990.41/ea
£0.00
£990.41/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Fibronectin, Human (Biotinylated, His-Avi)

Fibronectin, Human (Biotinylated, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.