Skip to product information
1 of 1

FITC-Labeled NKG2D/CD314, Human (HEK293, Fc-Flag)

FITC-Labeled NKG2D/CD314, Human (HEK293, Fc-Flag)

Size

SKU:QM-0176158-01

£390.90 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance, binding to multiple stress-inducing ligands on tumor and virus-infected cells. It plays a dual role by stimulating NK cells and enhancing T cell activation in CD8 (+) T cell-mediated adaptive responses. FITC-Labeled NKG2D/CD314 Protein, Human (HEK293, Fc) is the recombinant human-derived FITC-Labeled NKG2D/CD314 protein, expressed by HEK293 , with N-hFc, N-Flag labeled tag.

  • Molecular Formula

    22914 (Gene_ID) P26718 (F78-V216) (Accession)

  • Smiles

    FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year, protect from light

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0176158-01
20 µgQM-0176158-01
£390.90/ea
£0.00
£390.90/ea £0.00
50 µgQM-0176158-02
50 µgQM-0176158-02
£739.61/ea
£0.00
£739.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FITC-Labeled NKG2D/CD314, Human (HEK293, Fc-Flag)

FITC-Labeled NKG2D/CD314, Human (HEK293, Fc-Flag) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.