Skip to product information
1 of 1

FKBP11, Human (HEK293, Fc)

FKBP11, Human (HEK293, Fc)

Size

SKU:QM-0203764-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The FKBP11 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that plays a crucial role in accelerating protein folding, especially in complex protein synthesis. FKBP11 uses its enzymatic abilities to promote rapid and precise conformational changes that are critical for correct protein folding and maturation. FKBP11 Protein, Human (HEK293, Fc) is the recombinant human-derived FKBP11 protein, expressed by HEK293 , with C-mFc labeled tag.

  • Molecular Formula

    51303 (Gene_ID) Q9NYL4 (G28-G155) (Accession)

  • Smiles

    GLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKG

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203764-01
5 µgQM-0203764-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0203764-02
10 µgQM-0203764-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0203764-03
50 µgQM-0203764-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0203764-04
100 µgQM-0203764-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FKBP11, Human (HEK293, Fc)

FKBP11, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.