Skip to product information
1 of 1

FKBP14, Human (HEK293, His)

FKBP14, Human (HEK293, His)

Size

SKU:QM-0075556-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The FKBP14 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that uniquely accelerates protein folding, particularly in protein synthesis. FKBP14 particularly favors 4-hydroxyproline-modified substrates, exhibits significant affinity for type III collagen, and has potential effects on type VI and type X collagen. FKBP14 Protein, Human (HEK293, His) is the recombinant human-derived FKBP14 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    55033 (Gene_ID) Q9NWM8 (A20-K207) (Accession)

  • Smiles

    ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0075556-01
5 µgQM-0075556-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0075556-02
10 µgQM-0075556-02
£68.47/ea
£0.00
£68.47/ea £0.00
50 µgQM-0075556-03
50 µgQM-0075556-03
£193.37/ea
£0.00
£193.37/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FKBP14, Human (HEK293, His)

FKBP14, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.