FLRT1, Human (HEK293, His)

Name: FLRT1, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0203696-01
Price: 60.19 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203696-01

£60.19 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling.It helps increase the number and length of neurites. FLRT1 Protein, Human (HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
23769 (Gene_ID) Q9NZU1 (I21-P524) (Accession)
Smiles
IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203696-01	5 µgQM-0203696-01 £60.19/ea	£0.00	Quantity	£60.19/ea	£0.00

10 µgQM-0203696-02	10 µgQM-0203696-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0203696-03	50 µgQM-0203696-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0203696-04	100 µgQM-0203696-04 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

FLRT1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.