Skip to product information
1 of 1

FLRT1, Human (HEK293, His)

FLRT1, Human (HEK293, His)

Size

SKU:QM-0203696-01

£60.19 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling.It helps increase the number and length of neurites. FLRT1 Protein, Human (HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    23769 (Gene_ID) Q9NZU1 (I21-P524) (Accession)

  • Smiles

    IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203696-01
5 µgQM-0203696-01
£60.19/ea
£0.00
£60.19/ea £0.00
10 µgQM-0203696-02
10 µgQM-0203696-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0203696-03
50 µgQM-0203696-03
£238.32/ea
£0.00
£238.32/ea £0.00
100 µgQM-0203696-04
100 µgQM-0203696-04
£348.89/ea
£0.00
£348.89/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FLRT1, Human (HEK293, His)

FLRT1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.