Skip to product information
1 of 1

FLT3LG, Human (CHO)

FLT3LG, Human (CHO)

Size

SKU:QM-0204255-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. FLT3LG Protein, Human (CHO) is the recombinant human-derived FLT3LG protein, expressed by CHO cells , with tag free.

  • Molecular Formula

    2323 (Gene_ID) P49771-1 (T27-P185) (Accession)

  • Smiles

    TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204255-01
2 µgQM-0204255-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0204255-02
10 µgQM-0204255-02
£260.19/ea
£0.00
£260.19/ea £0.00
50 µgQM-0204255-03
50 µgQM-0204255-03
£591.89/ea
£0.00
£591.89/ea £0.00
100 µgQM-0204255-04
100 µgQM-0204255-04
£913.87/ea
£0.00
£913.87/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FLT3LG, Human (CHO)

FLT3LG, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.