1 1

FOLR1, Human (Biotinylated, HEK293, His-Avi)

FOLR1, Human (Biotinylated, HEK293, His-Avi)

Size

QM-0180342-01

Price on request

Request quote or documents

View full details

Product Details

  • Description

    The FOLR1 protein is an important mediator of folate uptake, binding to folate and promoting the delivery of 5-methyltetrahydrofolate into cells. Studies show high affinity at neutral pH. FOLR1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived FOLR1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    2348 (Gene_ID) P15328 (R25-S234) (Accession)

  • Smiles

    RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
100 µgQM-0180342-01
100 µgQM-0180342-01
£0.00/ea		 £0.00
£0.00/ea £0.00
20 µgQM-0180342-02
20 µgQM-0180342-02
£0.00/ea		 £0.00
£0.00/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

FOLR1, Human (Biotinylated, HEK293, His-Avi)

FOLR1, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.