Skip to product information
1 of 1

FOXM1, Human (His, SUMO-Myc)

FOXM1, Human (His, SUMO-Myc)

Size

SKU:QM-0199042-01

£115.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    FOXM1 is an important transcription factor that controls cell cycle gene expression critical for DNA replication and mitosis, underscoring its critical role in cellular processes. In addition to cell proliferation, FOXM1 contributes to DNA break repair and DNA damage checkpoint responses. FOXM1 Protein, Human (His, SUMO-Myc) is the recombinant human-derived FOXM1 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.

  • Molecular Formula

    2305 (Gene_ID) Q08050-1 (E235-L327) (Accession)

  • Smiles

    ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0199042-01
5 µgQM-0199042-01
£115.00/ea
£0.00
£115.00/ea £0.00
10 µgQM-0199042-02
10 µgQM-0199042-02
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0199042-03
50 µgQM-0199042-03
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FOXM1, Human (His, SUMO-Myc)

FOXM1, Human (His, SUMO-Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.