Frataxin/FXN, Human (His, Myc)

Name: Frataxin/FXN, Human (His, Myc)
Brand: QuantiMol
SKU: QM-0202409-01
Price: 63.29 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202409-01

£63.29 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Frataxin/FXN protein activates the core iron-sulfur cluster assembly complex and accelerates sulfur transfer for [2Fe-2S] cluster assembly. It plays a key role in the de novo synthesis of clusters, delivering persulfide to the ISCU. Frataxin/FXN Protein, Human (His, Myc) is the recombinant human-derived Frataxin/FXN protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
Molecular Formula
2395 (Gene_ID) Q16595-1 (M1-A210) (Accession)
Smiles
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Purity
92
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202409-01	2 µgQM-0202409-01 £63.29/ea	£0.00	Quantity	£63.29/ea	£0.00

10 µgQM-0202409-02	10 µgQM-0202409-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0202409-03	50 µgQM-0202409-03 £362.25/ea	£0.00	Quantity	£362.25/ea	£0.00

100 µgQM-0202409-04	100 µgQM-0202409-04 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Frataxin/FXN, Human (His, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.