Frizzled-1, Mouse (HEK293, Fc)

Name: Frizzled-1, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0179645-01
Price: 119.5 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0179645-01

£119.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Frizzled-1 is a Wnt receptor that is primarily activated by WNT7B and to varying degrees by WNT3A, WNT3, WNT1, and WNT2, while resisting activation by other Wnt proteins. Its fundamental role in canonical Wnt/β-catenin signaling involves promiscuous activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Frizzled-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
14362 (Gene_ID) O70421 (V69-H248) (Accession)
Smiles
VRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0179645-01	10 µgQM-0179645-01 £119.50/ea	£0.00	Quantity	£119.50/ea	£0.00

50 µgQM-0179645-02	50 µgQM-0179645-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Frizzled-1, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.