Skip to product information
1 of 1

Frizzled-10/CD350, Mouse (HEK293, His)

Frizzled-10/CD350, Mouse (HEK293, His)

Size

SKU:QM-0203586-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Frizzled-10/CD350 protein is a receptor for Wnt proteins that functions in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target gene activation. Secondary signaling pathways involve PKC and calcium flux. Frizzled-10/CD350 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    93897 (Gene_ID) Q8BKG4/NP_780493.1 (I22-G162) (Accession)

  • Smiles

    ISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRG

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203586-01
5 µgQM-0203586-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0203586-02
10 µgQM-0203586-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0203586-03
50 µgQM-0203586-03
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0203586-04
100 µgQM-0203586-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Frizzled-10/CD350, Mouse (HEK293, His)

Frizzled-10/CD350, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.