Frizzled-4/CD344, Human (HEK293, His)

Name: Frizzled-4/CD344, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0076150-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0076150-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The Frizzled-4/CD344 protein is a receptor for Wnt proteins and is associated with the classical β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. In retinal vascularization, it acts as a receptor for Wnt proteins and Norrin (NDP), stimulating β-catenin accumulation and LEF/TCF-mediated transcription. Frizzled-4/CD344 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
8322 (Gene_ID) Q9ULV1 (F37-E180) (Accession)
Smiles
FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0076150-01	5 µgQM-0076150-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0076150-02	10 µgQM-0076150-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0076150-03	50 µgQM-0076150-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0076150-04	100 µgQM-0076150-04 £392.63/ea	£0.00	Quantity	£392.63/ea	£0.00

500 µgQM-0076150-05	500 µgQM-0076150-05 £1,156.87/ea	£0.00	Quantity	£1,156.87/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Frizzled-4/CD344, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.