Skip to product information
1 of 1

Frizzled-7, Human (HEK293, His)

Frizzled-7, Human (HEK293, His)

Size

SKU:QM-0195546-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Frizzled-7 (FZD7) is a Wnt receptor that primarily activates the β-catenin classical pathway, involving Disheveled protein, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Some family members exhibit a second PKC and calcium flux signaling pathway, but the integration is unclear. Frizzled-7/FZD7 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-7/FZD7 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    8324 (Gene_ID) O75084 (Q33-L185) (Accession)

  • Smiles

    QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0195546-01
5 µgQM-0195546-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0195546-02
10 µgQM-0195546-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0195546-03
50 µgQM-0195546-03
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Frizzled-7, Human (HEK293, His)

Frizzled-7, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.