1 1

Frizzled-8, Human (Biotinylated, HEK293, His-Avi)

Frizzled-8, Human (Biotinylated, HEK293, His-Avi)

Size

QM-0174037-01

Price on request

Request quote or documents

View full details

Product Details

  • Description

    Frizzled-8 is a Wnt receptor that critically coordinates β-catenin signaling through the complex Wnt-Fzd-LRP5-LRP6 complex. It acts through the canonical Wnt/β-catenin pathway, activating scrambled proteins, inhibiting GSK-3 kinase, inducing nuclear β-catenin accumulation, and activating Wnt target genes. Frizzled-8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Frizzled-8 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    8325 (Gene_ID) Q9H461 (A28-P172) (Accession)

  • Smiles

    ASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPP

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
100 µgQM-0174037-01
100 µgQM-0174037-01
£0.00/ea		 £0.00
£0.00/ea £0.00
20 µgQM-0174037-02
20 µgQM-0174037-02
£0.00/ea		 £0.00
£0.00/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Frizzled-8, Human (Biotinylated, HEK293, His-Avi)

Frizzled-8, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.