Skip to product information
1 of 1

FSH, Human (HEK293, Flag-His)

FSH, Human (HEK293, Flag-His)

Size

SKU:QM-0203393-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Follicle-stimulating hormone (FSH) is a glycoprotein dimer polypeptide hormone produced by the anterior pituitary in response to gonadotropin-releasing hormone (GnRH) from the hypothalamus, which consists of Glycoprotein hormones α chain and Follitropin subunit β. FSH binds to FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. FSH is involved in follicle development and spermatogenesis in reproductive organs. FSH Protein, Human (HEK293, Flag-His) is a recombinant protein with a Flag-His label that consisting of 116 amino acids of Glycoprotein hormones α chain and 129 amino acids of Follitropin subunit β, which is expressed in HEK293 cells[1][2][3][4][5][6][7][8][9].

  • Molecular Formula

    1081&2488 (Gene_ID) P01215 (A25-S116) &P01225 (N19-E129) (Accession)

  • Smiles

    APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203393-01
2 µgQM-0203393-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0203393-02
10 µgQM-0203393-02
£238.32/ea
£0.00
£238.32/ea £0.00
50 µgQM-0203393-03
50 µgQM-0203393-03
£614.98/ea
£0.00
£614.98/ea £0.00
100 µgQM-0203393-04
100 µgQM-0203393-04
£1,065.74/ea
£0.00
£1,065.74/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FSH, Human (HEK293, Flag-His)

FSH, Human (HEK293, Flag-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.