Skip to product information
1 of 1

FTCD, Human (sf9, His)

FTCD, Human (sf9, His)

Size

SKU:QM-0194699-01

£106.93 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The FTCD protein is a folate-dependent enzyme with dual functions of transferase and deaminase activities. It plays a crucial role in directing the one-carbon units from methyliminoglutamic acid into the folate pool, contributing to the regulation of folate metabolism. FTCD Protein, Human (sf9, His) is the recombinant human-derived FTCD protein, expressed by Sf9 insect cells , with C-His labeled tag.

  • Molecular Formula

    10841 (Gene_ID) O95954-1 (M1-E541) (Accession)

  • Smiles

    MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

  • Purity

    95.2

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0194699-01
5 µgQM-0194699-01
£106.93/ea
£0.00
£106.93/ea £0.00
10 µgQM-0194699-02
10 µgQM-0194699-02
£152.38/ea
£0.00
£152.38/ea £0.00
50 µgQM-0194699-03
50 µgQM-0194699-03
£384.82/ea
£0.00
£384.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

FTCD, Human (sf9, His)

FTCD, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.