Skip to product information
1 of 1

Fusion glycoprotein F0/F, HRSV (His, B2M)

Fusion glycoprotein F0/F, HRSV (His, B2M)

Size

SKU:QM-0194704-01

£145.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The fusion glycoprotein F0/F protein is initially an inactive precursor that is cleaved by furin-like proteases to produce the mature F1 and F2 fusion glycoproteins. As a class I viral fusion protein, it undergoes prefusion, prehairpin, and postfusion states. Fusion glycoprotein F0/F Protein, HRSV (His, B2M) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by E. coli , with N-B2M, N-6*His labeled tag.

  • Molecular Formula

    / (Gene_ID) P03420 (N27-T529) (Accession)

  • Smiles

    NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0194704-01
5 µgQM-0194704-01
£145.38/ea
£0.00
£145.38/ea £0.00
10 µgQM-0194704-02
10 µgQM-0194704-02
£274.77/ea
£0.00
£274.77/ea £0.00
50 µgQM-0194704-03
50 µgQM-0194704-03
£678.15/ea
£0.00
£678.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Fusion glycoprotein F0/F, HRSV (His, B2M)

Fusion glycoprotein F0/F, HRSV (His, B2M) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.