Skip to product information
1 of 1

Fusion glycoprotein F0/F, HRSV (sf9, His)

Fusion glycoprotein F0/F, HRSV (sf9, His)

Size

SKU:QM-0203082-01

£168.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The fusion glycoprotein F0/F protein is initially an inactive precursor that is cleaved by furin-like proteases to produce the mature F1 and F2 fusion glycoproteins.As a class I viral fusion protein, it undergoes prefusion, prehairpin, and postfusion states.Fusion glycoprotein F0/F Protein, HRSV (sf9, His) is the recombinant Virus-derived Fusion glycoprotein F0/F protein, expressed by Sf9 insect cells , with C-His labeled tag.

  • Molecular Formula

    / (Gene_ID) P03420/AAB59858.1 (Q26-T529) (Accession)

  • Smiles

    QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

  • Purity

    95.9

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203082-01
5 µgQM-0203082-01
£168.13/ea
£0.00
£168.13/ea £0.00
10 µgQM-0203082-02
10 µgQM-0203082-02
£280.34/ea
£0.00
£280.34/ea £0.00
20 µgQM-0203082-03
20 µgQM-0203082-03
£406.69/ea
£0.00
£406.69/ea £0.00
50 µgQM-0203082-04
50 µgQM-0203082-04
£694.65/ea
£0.00
£694.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Fusion glycoprotein F0/F, HRSV (sf9, His)

Fusion glycoprotein F0/F, HRSV (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.