Skip to product information
1 of 1

FXN, Mouse (His)

FXN, Mouse (His)

Size

SKU:QM-0099780

Price on request
Quantity

Request quote or documents

View full details
  • Description

    FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (His) is the recombinant mouse-derived FXN protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    14297 (Gene_ID) O35943 (L78-T207) (Accession)

  • Smiles

    LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0099780
1 EachQM-0099780
£0.00/ea
£0.00
£0.00/ea £0.00

FXN, Mouse (His)

FXN, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.