Skip to product information
1 of 1

FXN, Rat

FXN, Rat

Size

SKU:QM-0085196

Price on request
Quantity

Request quote or documents

View full details
  • Description

    FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.

  • Molecular Formula

    499335 (Gene_ID) D3ZYW7 (L41-T208) (Accession)

  • Smiles

    LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0085196
1 EachQM-0085196
£0.00/ea
£0.00
£0.00/ea £0.00

FXN, Rat

FXN, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.