1 1

G-CSF, Human (CHO)

G-CSF, Human (CHO)

Size

QM-0202654-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    G-CSF Protein, Human (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

  • Molecular Formula

    1440 (Gene_ID) Q8N4W3 (T27-P200) /P09919-2 (T31-P204) (Accession)

  • Smiles

    TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0202654-01
2 µgQM-0202654-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0202654-02
10 µgQM-0202654-02
£97.00/ea		 £0.00
£97.00/ea £0.00
50 µgQM-0202654-03
50 µgQM-0202654-03
£282.06/ea		 £0.00
£282.06/ea £0.00
100 µgQM-0202654-04
100 µgQM-0202654-04
£448.52/ea		 £0.00
£448.52/ea £0.00
250 µgQM-0202654-05
250 µgQM-0202654-05
£825.17/ea		 £0.00
£825.17/ea £0.00
500 µgQM-0202654-06
500 µgQM-0202654-06
£1,289.30/ea		 £0.00
£1,289.30/ea £0.00
1 mgQM-0202654-07
1 mgQM-0202654-07
£2,042.60/ea		 £0.00
£2,042.60/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

G-CSF, Human (CHO)

G-CSF, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.