Skip to product information
1 of 1

G-CSF, Human (HEK293)

G-CSF, Human (HEK293)

Size

SKU:QM-0202560-01

£87.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free.

  • Molecular Formula

    1440 (Gene_ID) P09919-2/NP_757373.1 (A30-P204) (Accession)

  • Smiles

    ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

  • Purity

    97.2

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202560-01
2 µgQM-0202560-01
£87.26/ea
£0.00
£87.26/ea £0.00
5 µgQM-0202560-02
5 µgQM-0202560-02
£126.50/ea
£0.00
£126.50/ea £0.00
10 µgQM-0202560-03
10 µgQM-0202560-03
£172.63/ea
£0.00
£172.63/ea £0.00
50 µgQM-0202560-04
50 µgQM-0202560-04
£423.70/ea
£0.00
£423.70/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

G-CSF, Human (HEK293)

G-CSF, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.