G-CSF, Rat (HEK293)

Name: G-CSF, Rat (HEK293)
Brand: QuantiMol
SKU: QM-0203828-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203828-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
G-CSF Protein, Rat (HEK293) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells.
Molecular Formula
25610 (Gene_ID) P97712 (I22-I214) (Accession)
Smiles
IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203828-01	2 µgQM-0203828-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0203828-02	10 µgQM-0203828-02 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0203828-03	50 µgQM-0203828-03 £481.32/ea	£0.00	Quantity	£481.32/ea	£0.00

100 µgQM-0203828-04	100 µgQM-0203828-04 £786.29/ea	£0.00	Quantity	£786.29/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

G-CSF, Rat (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.