Skip to product information
1 of 1

GABARAPL1/GEC-1, Human (His)

GABARAPL1/GEC-1, Human (His)

Size

SKU:QM-0205568-01

£93.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GABARAPL1/GEC-1 is a multifunctional ubiquitin-like modifier that contributes to cell surface expression of kappa-type opioid receptors and contributes to autophagy, shaping autophagosome vacuoles.Unlike LC3, which is involved in phagophore elongation, the GABARAP/GATE-16 subfamily plays a crucial role in late autophagosome maturation.GABARAPL1/GEC-1 Protein, Human (His) is the recombinant human-derived GABARAPL1/GEC-1 protein, expressed by E.coli , with N-6*His labeled tag.

  • Molecular Formula

    23710 (Gene_ID) Q9H0R8 (M1-K117) (Accession)

  • Smiles

    MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

  • Purity

    95.3

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205568-01
5 µgQM-0205568-01
£93.63/ea
£0.00
£93.63/ea £0.00
10 µgQM-0205568-02
10 µgQM-0205568-02
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0205568-03
50 µgQM-0205568-03
£404.78/ea
£0.00
£404.78/ea £0.00
100 µgQM-0205568-04
100 µgQM-0205568-04
£647.78/ea
£0.00
£647.78/ea £0.00
500 µgQM-0205568-05
500 µgQM-0205568-05
£1,377.99/ea
£0.00
£1,377.99/ea £0.00
1 mgQM-0205568-06
1 mgQM-0205568-06
£1,932.04/ea
£0.00
£1,932.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GABARAPL1/GEC-1, Human (His)

GABARAPL1/GEC-1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.