Name: Galectin-3/LGALS3, Human
Brand: QuantiMol
SKU: QM-0205759-01
Price: 52.94 GBP
Availability: InStock

Product Details

Description
Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli[1][2].
Molecular Formula
3958 (Gene_ID) P17931 (A2-I250) (Accession)
Smiles
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205759-01	5 µgQM-0205759-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0205759-02	10 µgQM-0205759-02 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

50 µgQM-0205759-03	50 µgQM-0205759-03 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

100 µgQM-0205759-04	100 µgQM-0205759-04 £255.34/ea	£0.00	Quantity	£255.34/ea	£0.00

250 µgQM-0205759-05	250 µgQM-0205759-05 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

1 mgQM-0205759-06	1 mgQM-0205759-06 £847.04/ea	£0.00	Quantity	£847.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Galectin-3/LGALS3, Human

Galectin-3/LGALS3, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.