Galectin-4/LGALS4, Human (His)

Galectin-4/LGALS4 is a lactose-binding galectin protein with affinity for a variety of sugars. It is associated with the formation of adherens junctions, suggesting its potential role in cell adhesion processes. Galectin-4/LGALS4 Protein, Human (His) is the recombinant human-derived Galectin-4/LGALS4 protein, expressed by E. coli , with C-6*His labeled tag.

3960 (Gene_ID) P56470 (M1-I323) (Accession)

MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

97.9

Stored at -20°C for 2 years

Room temperature in continental US; may vary elsewhere.