Skip to product information
1 of 1

Galectin-8/LGALS8, Human (GST)

Galectin-8/LGALS8, Human (GST)

Size

SKU:QM-0129173

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    3964 (Gene_ID) O00214-1 (M1-W317) (Accession)

  • Smiles

    MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0129173
1 EachQM-0129173
£0.00/ea
£0.00
£0.00/ea £0.00

Galectin-8/LGALS8, Human (GST)

Galectin-8/LGALS8, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.