Galectin-8/LGALS8, Human (GST)
Galectin-8/LGALS8, Human (GST)
SKU:QM-0129173
Request quote or documents

Product Details
-
Description
Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.
-
Molecular Formula
3964 (Gene_ID) O00214-1 (M1-W317) (Accession)
-
Smiles
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Galectin-8/LGALS8, Human (GST)
Galectin-8/LGALS8, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.