Skip to product information
1 of 1

GALNT10, Human (HEK293, His)

GALNT10, Human (HEK293, His)

Size

SKU:QM-0204532-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GALNT10 protein assumes a crucial role in the initiation of O-linked oligosaccharide biosynthesis, facilitating the transfer of an N-acetyl-D-galactosamine residue to specific serine or threonine residues on protein receptors. With its catalytic activity, GALNT10 demonstrates specificity towards substrates such as Muc5Ac and EA2 peptides, contributing to the intricate process of protein glycosylation and subsequent cellular functions. GALNT10 Protein, Human (HEK293, His) is the recombinant human-derived GALNT10 protein, expressed by HEK293 , with N-His labeled tag.

  • Molecular Formula

    55568 (Gene_ID) Q86SR1-1/NP_938080.1 (T39-N603) (Accession)

  • Smiles

    TPGGSGAAVAPAAGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204532-01
5 µgQM-0204532-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0204532-02
10 µgQM-0204532-02
£122.88/ea
£0.00
£122.88/ea £0.00
50 µgQM-0204532-03
50 µgQM-0204532-03
£359.82/ea
£0.00
£359.82/ea £0.00
100 µgQM-0204532-04
100 µgQM-0204532-04
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GALNT10, Human (HEK293, His)

GALNT10, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.