GDF-15, Mouse (HEK293, His-Flag)

Name: GDF-15, Mouse (HEK293, His-Flag)
Brand: QuantiMol
SKU: QM-0174155-01
Price: 204.31 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0174155-01

£204.31 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL.This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress.GDF-15 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived GDF-15 protein, expressed by HEK293 , with N-8*His, N-Flag labeled tag.
Molecular Formula
23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)
Smiles
SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0174155-01	10 µgQM-0174155-01 £204.31/ea	£0.00	Quantity	£204.31/ea	£0.00

50 µgQM-0174155-02	50 µgQM-0174155-02 £481.32/ea	£0.00	Quantity	£481.32/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GDF-15, Mouse (HEK293, His-Flag) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.