Skip to product information
1 of 1

GDF-15, Mouse (His)

GDF-15, Mouse (His)

Size

SKU:QM-0100312

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The GDF-15 protein regulates food intake, energy balance, and body weight by binding to its receptor GFRAL. This activates GFRAL-expressing neurons in the brainstem, triggering "emergency circuits" in the central parabrachial nucleus and amygdala during stress. GDF-15 Protein, Mouse (His) is the recombinant mouse-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

  • Molecular Formula

    23886 (Gene_ID) Q9Z0J7-1 (S189-A303) (Accession)

  • Smiles

    SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0100312
1 EachQM-0100312
£0.00/ea
£0.00
£0.00/ea £0.00

GDF-15, Mouse (His)

GDF-15, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.