GDNF, Human

Name: GDNF, Human
Brand: QuantiMol
SKU: QM-0202895-01
Price: 101.5 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0202895-01

£101.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human is produced in E.coil, and consists of 134 amino acids (S78-I211) .
Molecular Formula
2668 (Gene_ID) P39905-1 (S78-I211) (Accession)
Smiles
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Purity
97.66
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202895-01	2 µgQM-0202895-01 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

10 µgQM-0202895-02	10 µgQM-0202895-02 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

50 µgQM-0202895-03	50 µgQM-0202895-03 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GDNF, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.