GDNF, Human (HEK293)

Name: GDNF, Human (HEK293)
Brand: QuantiMol
SKU: QM-0204663-01
Price: 62.26 GBP
Availability: InStock

Size 2 µg 10 µg 20 µg 50 µg 100 µg

SKU:QM-0204663-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human (HEK293) is produced in HEK293 cells, and consists of 103 amino acids (R83-I185) .
Molecular Formula
2668 (Gene_ID) P39905-2 (R83-I185) (Accession)
Smiles
RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204663-01	2 µgQM-0204663-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0204663-02	10 µgQM-0204663-02 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

20 µgQM-0204663-03	20 µgQM-0204663-03 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0204663-04	50 µgQM-0204663-04 £299.07/ea	£0.00	Quantity	£299.07/ea	£0.00

100 µgQM-0204663-05	100 µgQM-0204663-05 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GDNF, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.