GDNF, Human (His)

Name: GDNF, Human (His)
Brand: QuantiMol
SKU: QM-0201644-01
Price: 70.54 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0201644-01

£70.54 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human (His) is produced in E.coil with six N-Terminal His-tags. It consists of 134 amino acids (S78-I211) .
Molecular Formula
2668 (Gene_ID) P39905-1 (S78-I211) (Accession)
Smiles
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0201644-01	2 µgQM-0201644-01 £70.54/ea	£0.00	Quantity	£70.54/ea	£0.00

10 µgQM-0201644-02	10 µgQM-0201644-02 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

50 µgQM-0201644-03	50 µgQM-0201644-03 £440.01/ea	£0.00	Quantity	£440.01/ea	£0.00

100 µgQM-0201644-04	100 µgQM-0201644-04 £714.61/ea	£0.00	Quantity	£714.61/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GDNF, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.