GDNF, Mouse (CHO)

Name: GDNF, Mouse (CHO)
Brand: QuantiMol
SKU: QM-0203635-01
Price: 188.51 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203635-01

£188.51 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Mouse (CHO) is produced in CHO cells, and consists of 134 amino acids (S78-I211) .
Molecular Formula
14573 (Gene_ID) P48540 (S78-I211) (Accession)
Smiles
MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203635-01	5 µgQM-0203635-01 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

10 µgQM-0203635-02	10 µgQM-0203635-02 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

50 µgQM-0203635-03	50 µgQM-0203635-03 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

100 µgQM-0203635-04	100 µgQM-0203635-04 £1,079.11/ea	£0.00	Quantity	£1,079.11/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GDNF, Mouse (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.