Skip to product information
1 of 1

GFPT1, Human

GFPT1, Human

Size

SKU:QM-0204421-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    As a key regulator of glucose influx into the hexosamine pathway, the GFPT1 protein plays a key role in controlling the availability of protein N- and O-linked glycosylation precursors. In addition, GFPT1 is involved in the regulation of circadian expression of clock genes BMAL1 and CRY1 and contributes to the complex regulation of cytoplasmic UDP-GlcNAc metabolic fluctuations. GFPT1 Protein, Human is the recombinant human-derived GFPT1 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    2673 (Gene_ID) Q06210-1/AAA58502.1 (Q332-E699) (Accession)

  • Smiles

    QQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204421-01
5 µgQM-0204421-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0204421-02
10 µgQM-0204421-02
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0204421-03
50 µgQM-0204421-03
£359.82/ea
£0.00
£359.82/ea £0.00
100 µgQM-0204421-04
100 µgQM-0204421-04
£580.96/ea
£0.00
£580.96/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GFPT1, Human

GFPT1, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.