GH/Somatotropin, Mouse

Name: GH/Somatotropin, Mouse
Brand: QuantiMol
SKU: QM-0205169-01
Price: 127.38 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg 500 µg 1 mg

SKU:QM-0205169-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
GH/Somatotropin Protein, Mouse is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the growth disorders research.
Molecular Formula
14599 (Gene_ID) P06880 (F27-F216) (Accession)
Smiles
FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0205169-01	10 µgQM-0205169-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0205169-02	50 µgQM-0205169-02 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0205169-03	100 µgQM-0205169-03 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

500 µgQM-0205169-04	500 µgQM-0205169-04 £935.74/ea	£0.00	Quantity	£935.74/ea	£0.00

1 mgQM-0205169-05	1 mgQM-0205169-05 £1,323.32/ea	£0.00	Quantity	£1,323.32/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GH/Somatotropin, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.