Skip to product information
1 of 1

GhrA, E.coli (His-SUMO)

GhrA, E.coli (His-SUMO)

Size

SKU:QM-0102960

Price on request
Quantity

Request quote or documents

View full details
  • Description

    GhrA is an enzyme involved in cellular metabolism and plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity contributes to the conversion of important metabolites and contributes to metabolic pathways related to glyoxylate detoxification and maintenance of cellular homeostasis. GhrA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived GhrA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

  • Molecular Formula

    / (Gene_ID) B7LFE3 (M1-Y312) (Accession)

  • Smiles

    MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0102960
1 EachQM-0102960
£0.00/ea
£0.00
£0.00/ea £0.00

GhrA, E.coli (His-SUMO)

GhrA, E.coli (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.