Name: GIP, Human (HEK293, hFc)
Brand: QuantiMol
SKU: QM-0205717-01
Price: 67.44 GBP
Availability: InStock

Product Details

Description
The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)
Smiles
EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205717-01	5 µgQM-0205717-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0205717-02	10 µgQM-0205717-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0205717-03	50 µgQM-0205717-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0205717-04	100 µgQM-0205717-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

500 µgQM-0205717-05	500 µgQM-0205717-05 £1,289.30/ea	£0.00	Quantity	£1,289.30/ea	£0.00

1 mgQM-0205717-06	1 mgQM-0205717-06 £2,153.16/ea	£0.00	Quantity	£2,153.16/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GIP, Human (HEK293, hFc)

GIP, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.