GITR, Cynomolgus (HEK293, Fc)

Name: GITR, Cynomolgus (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0204213-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204213-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
GITR Protein, Cynomolgus (HEK293, Fc) is the recombinant Rhesus Macaque-derived GITR protein, expressed by HEK293, with C-hFc labeled tag.
Molecular Formula
102146362 (Gene_ID) XP_005545180.2 (Q20-E155) (Accession)
Smiles
QRPTGGPGCGPGRLLLGTGKDARCCRVHPTRCCRDYQSEECCSEWDCVCVQPEFHCGNPCCTTCQHHPCPSGQGVQPQGKFSFGFRCVDCALGTFSRGHDGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204213-01	5 µgQM-0204213-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0204213-02	10 µgQM-0204213-02 £93.63/ea	£0.00	Quantity	£93.63/ea	£0.00

50 µgQM-0204213-03	50 µgQM-0204213-03 £257.76/ea	£0.00	Quantity	£257.76/ea	£0.00

100 µgQM-0204213-04	100 µgQM-0204213-04 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GITR, Cynomolgus (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.