GITR, Mouse (HEK293, His)

Name: GITR, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0202359-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202359-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Mouse (HEK293, His) is a recombinant protein with a C-terminal His label and is produced in HEK293 cells.
Molecular Formula
21936 (Gene_ID) O35714-1/NP_033426.1 (S22-Q150) (Accession)
Smiles
SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQ
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202359-01	2 µgQM-0202359-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0202359-02	10 µgQM-0202359-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0202359-03	50 µgQM-0202359-03 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

100 µgQM-0202359-04	100 µgQM-0202359-04 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GITR, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.