Skip to product information
1 of 1

GJA1, Human (His)

GJA1, Human (His)

Size

SKU:QM-0200907-01

£147.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    2697 (Gene_ID) P17302 (F233-I382) (Accession)

  • Smiles

    FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200907-01
5 µgQM-0200907-01
£147.63/ea
£0.00
£147.63/ea £0.00
10 µgQM-0200907-02
10 µgQM-0200907-02
£277.21/ea
£0.00
£277.21/ea £0.00
50 µgQM-0200907-03
50 µgQM-0200907-03
£559.09/ea
£0.00
£559.09/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GJA1, Human (His)

GJA1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.