Skip to product information
1 of 1

GLP-1/GCG, Human (HEK293, His)

GLP-1/GCG, Human (HEK293, His)

Size

SKU:QM-0199795-01

£252.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    GLP-1 and GCG are two proteins derived from the same precursor protein, which is encoded by the GCG-glucagon gene. The GCG protein is a counterregulatory hormone to insulin, playing a crucial role in glucose metabolism by increasing gluconeogenesis and reducing glycolysis to regulate blood glucose levels. GLP-1 protein, secreted by intestinal endocrine cells, promotes insulin secretion, regulates gastrointestinal motility, and inhibits the secretion of GCG protein. GLP-1/GCG protein, Human (HEK293, His), is a recombinant GLP-1/GCG protein expressed by HEK293 cells, with a His tag at the C-terminus, and is composed of 160 amino acids (R21-K180) [1][2][3][4][5][6][7][8][9][10].

  • Molecular Formula

    2641 (Gene_ID) P01275 (R21-K180) (Accession)

  • Smiles

    RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0199795-01
10 µgQM-0199795-01
£252.39/ea
£0.00
£252.39/ea £0.00
50 µgQM-0199795-02
50 µgQM-0199795-02
£573.15/ea
£0.00
£573.15/ea £0.00
100 µgQM-0199795-03
100 µgQM-0199795-03
£872.04/ea
£0.00
£872.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GLP-1/GCG, Human (HEK293, His)

GLP-1/GCG, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.