Skip to product information
1 of 1

GLP1R, Human (HEK293, N-His, C-Myc)

GLP1R, Human (HEK293, N-His, C-Myc)

Size

SKU:QM-0193996-01

£232.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The GLP1R protein is a G protein-coupled receptor for glucagon-like peptide 1 (GLP-1), which upon ligand binding activates adenylyl cyclase and increases cAMP levels. This interaction critically regulates insulin secretion, affecting cellular responses and metabolic processes associated with GLP-1 signaling. GLP1R Protein, Human (HEK293, N-His, C-Myc) is the recombinant human-derived GLP1R protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

  • Molecular Formula

    2740 (Gene_ID) P43220 (R24-Y145) (Accession)

  • Smiles

    RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0193996-01
20 µgQM-0193996-01
£232.25/ea
£0.00
£232.25/ea £0.00
50 µgQM-0193996-02
50 µgQM-0193996-02
£398.70/ea
£0.00
£398.70/ea £0.00
100 µgQM-0193996-03
100 µgQM-0193996-03
£604.04/ea
£0.00
£604.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

GLP1R, Human (HEK293, N-His, C-Myc)

GLP1R, Human (HEK293, N-His, C-Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.