Glucosamine (N-acetyl) -6-Sulfatase/GNS, Human (HEK293, His)
Glucosamine (N-acetyl) -6-Sulfatase/GNS, Human (HEK293, His)
SKU:QM-0189409-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
Glucosamine (N-acetyl) -6-Sulfatase/GNS Protein is a lysosomal enzyme present in all cells. It is involved in the catabolism of heparin, heparin sulfate and keratin sulfate. Deficiency of this enzyme leads to inadequate substrate accumulation and lysosomal storage impairment IIID mucopolysaccharidosis. Glucosamine (N-acetyl) -6-Sulfatase/GNS Protein, Human (HEK293, His) is the recombinant human-derived Glucosamine, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
2799 (Gene_ID) P15586-1 (V37-L552) (Accession)
-
Smiles
VFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL
-
Purity
95
-
Storage Conditions
Stored at -80°C for 1 year
-
Shipping Conditions
Dry ice.
Related Products
- QM-0086965-01 Sterile 10 mM Histidine, pH 5.5 buffer
- QM-0162455-01 L-Methionine-13C, d3 [CAS 73488-65-0]
- QM-0009933-01 L-Histidine buffer, Sterile
- QM-0183109-01 ε-Poly-L-lysine (hydrochloride) (MV 2000-5000)
- QM-0131878-01 ε-Poly-L-lysine (MW 3800-4200) [CAS 28211-04-3]
- QM-0067179 γ-L-Glutamyl-S-allyl-L-cysteine [CAS 1299925-32-8]
- QM-0048489-01 β-N-methylamino-L-alanine (hydrochloride) (Standard) [CAS 16012-55-8]
- QM-0025942-01 Valylleucine (TFA) [CAS 27530-02-5]
- QM-0024513 γ-Glutamylornithine (Standard) [CAS 56523-61-6]
- QM-0024512 β-Lysine [CAS 4299-56-3]
Other industry favorites
- QM-0086965-01 Sterile 10 mM Histidine, pH 5.5 buffer
- QM-0162455-01 L-Methionine-13C, d3 [CAS 73488-65-0]
- QM-0205375-01 γ-Glutamyl-S-allylcysteine [CAS 91216-95-4]
- QM-0204930-01 α-Methyl-DL-aspartic acid [CAS 2792-66-7]
- QM-0161381-01 β-1,3-N-Acetylglucosaminyltransferase 4
- QM-0162316-01 β-Alanine-15N [CAS 204451-53-6]
- QM-0013113 β-Hydroxybutyrate methionine
- QM-0005220-01 β-cyano-L-Alanine (Standard) [CAS 6232-19-5]
- QM-0161380-01 α-1,4-N-Acetylglucosaminyltransferase 4
- QM-0143593-01 Ziprasidone amino acid [CAS 1159977-64-6]
Glucosamine (N-acetyl) -6-Sulfatase/GNS, Human (HEK293, His)
Glucosamine (N-acetyl) -6-Sulfatase/GNS, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.