Skip to product information
1 of 1

Glycoprotein D/gD, HHV-2 (Cell-Free, His)

Glycoprotein D/gD, HHV-2 (Cell-Free, His)

Size

SKU:QM-0124305

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Glycoprotein D/gD proteins bind to host cell receptors TNFRSF14/HVEM and NECTIN1, triggering fusion with the host membrane by recruiting gB and gH/gL. glycoprotein D/gD Protein, HHV-2 (Cell-Free, His) is the recombinant Virus-derived glycoprotein D/gD protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

  • Molecular Formula

    1487358 (Gene_ID) Q69467 (K26-Y393) (Accession)

  • Smiles

    KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0124305
1 EachQM-0124305
£0.00/ea
£0.00
£0.00/ea £0.00

Glycoprotein D/gD, HHV-2 (Cell-Free, His)

Glycoprotein D/gD, HHV-2 (Cell-Free, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.