Glycoprotein D/gD, HHV-2 (Cell-Free, His)
Glycoprotein D/gD, HHV-2 (Cell-Free, His)
SKU:QM-0124305
Request quote or documents

Product Details
-
Description
Glycoprotein D/gD proteins bind to host cell receptors TNFRSF14/HVEM and NECTIN1, triggering fusion with the host membrane by recruiting gB and gH/gL. glycoprotein D/gD Protein, HHV-2 (Cell-Free, His) is the recombinant Virus-derived glycoprotein D/gD protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
-
Molecular Formula
1487358 (Gene_ID) Q69467 (K26-Y393) (Accession)
-
Smiles
KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAPPSHQPLFY
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Glycoprotein D/gD, HHV-2 (Cell-Free, His)
Glycoprotein D/gD, HHV-2 (Cell-Free, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.