GM-CSF, Canine

Name: GM-CSF, Canine
Brand: QuantiMol
SKU: QM-0198766-01
Price: 133.0 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0198766-01

£133.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CSF2 protein is a cytokine that plays a critical role in the regulation of immune responses and hematopoiesis. It stimulates the production and differentiation of white blood cells, including macrophages and granulocytes. GM-CSF Protein, Canine is the recombinant canine-derived GM-CSF protein, expressed by E. coli , with tag free.
Molecular Formula
403923 (Gene_ID) P48749 (A18-K144) (Accession)
Smiles
APTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDCWKPVKK
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0198766-01	5 µgQM-0198766-01 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

10 µgQM-0198766-02	10 µgQM-0198766-02 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

50 µgQM-0198766-03	50 µgQM-0198766-03 £604.04/ea	£0.00	Quantity	£604.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

GM-CSF, Canine is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.